
GP10118
Amyloid Beta-Peptide (1-40) (human)
Amyloid β-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329·8· Amyloid beta (Aβ or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor
ProteinHostC194H295N53O58S
- Host / source
- C194H295N53O58S
- Applications
- 4329.86
- Catalogue number
- GP10118
- Brand
- GLPBIO
Ordering in Israel
- Lead time
- Ships from the manufacturer to your lab in 8–14 business days; customs and cold chain handled by LABO Scientific.
- Pricing
- Quoted in ILS, excl. VAT. Add the item to your quote and we confirm the final price, usually the same business day.
- Documents
- Lot certificate of analysis and manufacturer SDS are emailed with your order confirmation.
- Who we serve
- Universities, hospitals and biotech companies across Israel. Research use only — not for diagnostic or therapeutic use.
- Questions
- WhatsApp · +972-55-990-7576 · orders@labo.co.il