
GC92124
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a derivative of the endogenous incretin hormone glucagon-like peptide 1 (GLP-1)
ChemicalMW3692.1FormulaC164H252N42O53S ? XCF3COOH
- CAS number
- —
- Molecular weight
- 3692.1
- Formula
- C164H252N42O53S ? XCF3COOH
- Solubility
- DMSO: Soluble: ≥10 mg/ml,Ethanol: Sparingly soluble: 1–10 mg/ml,PBS (pH 7·2): Sparingly soluble: 1–10 mg/ml
- Catalogue number
- GC92124
- Brand
- GLPBIO
Ordering in Israel
- Lead time
- Ships from the manufacturer to your lab in 8–14 business days; customs and cold chain handled by LABO Scientific.
- Pricing
- Quoted in ILS, excl. VAT. Add the item to your quote and we confirm the final price, usually the same business day.
- Documents
- Lot certificate of analysis and manufacturer SDS are emailed with your order confirmation.
- Who we serve
- Universities, hospitals and biotech companies across Israel. Research use only — not for diagnostic or therapeutic use.
- Questions
- WhatsApp · +972-55-990-7576 · orders@labo.co.il