
GC61927
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2
ChemicalMW3649.88FormulaC164H238N40O55
- CAS number
- —
- Molecular weight
- 3649.88
- Formula
- C164H238N40O55
- Catalogue number
- GC61927
- Brand
- GLPBIO
Ordering in Israel
- Lead time
- Ships from the manufacturer to your lab in 8–14 business days; customs and cold chain handled by LABO Scientific.
- Pricing
- Quoted in ILS, excl. VAT. Add the item to your quote and we confirm the final price, usually the same business day.
- Documents
- Lot certificate of analysis and manufacturer SDS are emailed with your order confirmation.
- Who we serve
- Universities, hospitals and biotech companies across Israel. Research use only — not for diagnostic or therapeutic use.
- Questions
- WhatsApp · +972-55-990-7576 · orders@labo.co.il