GA23241
Nesfatin-1 (30-59) (mouse, rat)
Nesfatin-1 (30-59), YDEYLKQVIEVLETDPHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1· The fragment induces dose-dependent reduction of food intake· The mouse sequence differs in two positions from the human fragment
ChemicalCAS1872441-22-9MW3692.14FormulaC167H260N40O54
- CAS number
- 1872441-22-9
- Molecular weight
- 3692.14
- Formula
- C167H260N40O54
- Solubility
- Soluble in DMSO
- Catalogue number
- GA23241
- Brand
- GLPBIO
Ordering in Israel
- Lead time
- Ships from the manufacturer to your lab in 8–14 business days; customs and cold chain handled by LABO Scientific.
- Pricing
- Quoted in ILS, excl. VAT. Add the item to your quote and we confirm the final price, usually the same business day.
- Documents
- Lot certificate of analysis and manufacturer SDS are emailed with your order confirmation.
- Who we serve
- Universities, hospitals and biotech companies across Israel. Research use only — not for diagnostic or therapeutic use.
- Questions
- WhatsApp · +972-55-990-7576 · orders@labo.co.il